Analytical Data
-
Gene name
PIK3CG
- Application
-
Alternative Names
PIK3CG；Phosphatidylinositol 4.5-bisphosphate 3-kinase catalytic subunit gamma isoform
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48736
-
Expression Region
828-1073aa
-
AA Sequence
IGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIE
-
Molecular Weight
35.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PIK3CG, or phosphoinositide 3-kinase gamma, is a pivotal enzyme in the PI3K signaling pathway, which plays a crucial role in various cellular processes, including growth, metabolism, and immune responses. Dysregulation of PIK3CG has been implicated in several diseases, particularly cancer and inflammatory disorders, making it a significant target for therapeutic intervention. The enzyme exists as a heterodimer consisting of a catalytic subunit (p110γ) and a regulatory subunit (p85), and its activity is stimulated by diverse cellular signals, including growth factors and cytokines. Research into recombinant PIK3CG protein focuses on elucidating its structure, function, and regulatory mechanisms, as well as its interactions with other signaling molecules. Recombinant PIK3CG can be produced in various expression systems for in vitro studies, enabling researchers to investigate its enzymatic activity and the effects of potential inhibitors. Understanding the precise role of PIK3CG in disease pathways could lead to the development of novel targeted therapies. Furthermore, studies on the recombinant protein can aid in identifying biomarkers for disease progression and drug response. Thus, the exploration of PIK3CG and its recombinant forms is essential for advancing our knowledge of cellular signaling and developing therapeutic strategies for diseases associated with aberrant PI3K signaling.
