Analytical Data
-
Gene name
HDDC3
- Application
-
Alternative Names
HDDC3;MESH1;Guanosine-3'.5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N4P3
-
Expression Region
1-140aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHLDEVELHFGAQVRRLVEEVTDDKTLPKLER KRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKIQMGSEAAQLLE AADFAARKHRQQRRKDPEGTPYINHPIGVARILTHEAGITDIVVLQAALL HDTVEDTDTT
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HDDC3, or Hydrolase Domain-Containing Protein 3, is a protein that belongs to a family of hydrolases and has garnered interest in recent years due to its potential roles in various biological processes and disease mechanisms. Research has indicated that HDDC3 may be involved in the regulation of metabolic pathways, immune responses, and cellular stress responses. Its expression has been linked to certain diseases, including various forms of cancer and neurodegenerative disorders, prompting investigations into its functional properties and regulatory mechanisms. The molecular structure of HDDC3 suggests that it may have enzymatic activity, possibly influencing lipid metabolism and signaling pathways. Understanding the role of HDDC3 at a molecular level can provide insights into its involvement in health and disease, paving the way for the development of novel therapeutic strategies. Significant research efforts are focused on elucidating its biological functions, interactions with other proteins, and potential as a biomarker or therapeutic target, thus establishing HDDC3 as a significant protein in the field of molecular biology and medicine.











