Cat: PA1000-1419

Recombinant Human HDDC3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HDDC3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HDDC3;MESH1;Guanosine-3'.5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N4P3

  • Expression Region

    1-140aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHLDEVELHFGAQVRRLVEEVTDDKTLPKLER KRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKIQMGSEAAQLLE AADFAARKHRQQRRKDPEGTPYINHPIGVARILTHEAGITDIVVLQAALL HDTVEDTDTT

  • Molecular Weight

    18 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HDDC3, or Hydrolase Domain-Containing Protein 3, is a protein that belongs to a family of hydrolases and has garnered interest in recent years due to its potential roles in various biological processes and disease mechanisms. Research has indicated that HDDC3 may be involved in the regulation of metabolic pathways, immune responses, and cellular stress responses. Its expression has been linked to certain diseases, including various forms of cancer and neurodegenerative disorders, prompting investigations into its functional properties and regulatory mechanisms. The molecular structure of HDDC3 suggests that it may have enzymatic activity, possibly influencing lipid metabolism and signaling pathways. Understanding the role of HDDC3 at a molecular level can provide insights into its involvement in health and disease, paving the way for the development of novel therapeutic strategies. Significant research efforts are focused on elucidating its biological functions, interactions with other proteins, and potential as a biomarker or therapeutic target, thus establishing HDDC3 as a significant protein in the field of molecular biology and medicine. 

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US