Analytical Data
-
Gene name
HSPC171
- Application
-
Alternative Names
TMEM208; HSPC171; Transmembrane protein 208
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BTX3
-
Expression Region
1-173aa
-
AA Sequence
MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFSLAVYGASYHSMSSMARAAFSEYGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYVWSFWLLAPGRALYLLWVNVLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL
-
Molecular Weight
46.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HSPC171, also known as non-specific cytotoxic cell receptor protein 1 (NCR1), is a member of the C-type lectin-like receptor family and has garnered attention in immunology research due to its role in immune responses, particularly in natural killer (NK) cells and certain T-cell populations. Understanding the molecular mechanisms of HSPC171 is crucial, as it is implicated in various physiological and pathological processes, including tumor immunology and autoimmune diseases. The focus on recombinant HSPC171 protein stems from its potential applications in therapeutic strategies, such as cancer immunotherapy, where enhancing NK cell activity can improve tumor targeting and elimination. Research has demonstrated that HSPC171 can modulate immune signaling pathways, making it a viable candidate for further investigations into its structural properties and functional dynamics. By generating recombinant HSPC171, scientists aim to explore its binding characteristics, evaluate its immunogenicity, and assess its effects on various immune cell types. This research is essential not only for understanding the basic biology of HSPC171 but also for its potential utilization in developing innovative immunotherapeutic approaches to treat cancers and other immune-related disorders. Thus, advances in the study of HSPC171 and its recombinant protein provide a critical foundation for future breakthroughs in immunology and therapeutic interventions.
