Analytical Data
-
Gene name
HBEGF
- Application
-
Alternative Names
HBEGF;DTR;DTS;HEGFL;Proheparin-binding EGF-like growth factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99075
-
Expression Region
63-148aa
-
AA Sequence
DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKY KDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
-
Molecular Weight
10 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HB-EGF (Heparin-binding EGF-like growth factor) is a member of the epidermal growth factor (EGF) family and plays a crucial role in various physiological and pathological processes, including cell growth, differentiation, wound healing, and inflammation. Its unique structure allows it to interact with multiple receptors, notably the EGF receptor (EGFR) and the heparan sulfate proteoglycans, which enhances its biological activity. Research has indicated that HB-EGF is overexpressed in several cancers, making it a potential marker for tumor progression and a target for therapeutic interventions. Moreover, HB-EGF is involved in the regulation of cellular responses to stress and injury, suggesting its significance in tissue repair mechanisms. The recombinant production of HB-EGF has become a focal point in biotechnological studies, enabling detailed investigations into its functions and therapeutic applications. By utilizing recombinant DNA technology, researchers can produce HB-EGF in a controlled manner, facilitating studies on its role in promoting cell proliferation and survival, as well as its impact on various signaling pathways. This not only enhances our understanding of HB-EGF's biological functions but also paves the way for developing new strategies in cancer treatment and regenerative medicine. Overall, the study of recombinant HB-EGF is vital for elucidating its multifaceted roles in health and disease, and it holds promise for innovative therapeutic approaches in conditions where HB-EGF modulation could be beneficial.
