Analytical Data
-
Gene name
CXCR7
- Application
-
Alternative Names
CXCR7；CMKOR1；CXCR7；GPR159；Atypical chemokine receptor 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25106
-
Expression Region
1-40aa
-
AA Sequence
MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNK
-
Molecular Weight
20.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXCR7, also known as C-X-C chemokine receptor type 7, is a G-protein coupled receptor that plays a critical role in various physiological and pathological processes, including immune responses, cancer progression, and cardiovascular diseases. Initially identified as a receptor for the chemokines CXCL11 and CXCL12, it is now recognized for its function in modulating cellular migration and signaling pathways. Research has indicated that CXCR7 may act as a scavenger receptor, regulating the availability of its ligands and contributing to their receptor signaling. The involvement of CXCR7 in tumor microenvironments has led to interest in its potential as a therapeutic target. Overexpression of CXCR7 has been linked to poor prognosis in several cancers, highlighting the necessity for a better understanding of its biochemical properties and interactions. Recombinant protein technology has emerged as a valuable tool to investigate CXCR7's structure and function. By producing and purifying CXCR7 as a recombinant protein, researchers can explore its binding affinities, signaling cascades, and interactions with other molecules. This foundational knowledge could lead to novel strategies for targeting CXCR7 in disease contexts, implicating significant implications for drug development and therapeutic interventions aimed at mitigating cancer and enhancing immune responses. Overall, the study of CXCR7 recombinant proteins is crucial in delineating its biological roles and therapeutic potential, thereby contributing to advancements in biomedical science and novel treatment modalities.
