Analytical Data
-
Gene name
AZU
- Application
-
Alternative Names
AZU；Transforming acidic coiled-coil-containing Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20160
-
Expression Region
27-250aa
-
AA Sequence
IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGV STVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREAN LTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTP EDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGP DFFTRVALFRDWIDGVLNNPGPGP
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AZU (Azurocidin) is a protein predominantly expressed in neutrophils, functioning as part of the innate immune response. Its primary role is to exhibit antimicrobial properties and contribute to tissue repair mechanisms. Research into AZU has gained momentum due to its involvement in various diseases, particularly those linked to inflammation and infection. Studies have demonstrated that AZU can influence the migration and activation of immune cells, making it a potential target for therapeutic interventions in conditions such as sepsis, chronic inflammatory diseases, and cancer. Moreover, the structural characteristics of AZU have sparked interest in its possible applications in drug delivery systems and biomaterials due to its stability and biological activity. An understanding of AZU’s molecular mechanisms and interactions is crucial for elucidating its role in health and disease, paving the way for innovative treatments that harness its unique properties. As a result, AZU is a focus of ongoing research aiming to explore its potential as a biomarker for inflammatory disorders and its application in developing new therapeutic strategies.
