Analytical Data
-
Gene name
GUK1
- Application
-
Alternative Names
GUK1;GMK;GMPK;Guanylate kinase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16774
-
Expression Region
2-197aa
-
AA Sequence
SGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
-
Molecular Weight
37.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GUK1, or guanylate kinase 1, is an essential enzyme involved in the nucleotide metabolism, specifically in the regeneration of guanosine monophosphate (GMP) and guanosine triphosphate (GTP). The proper functioning of GUK1 is crucial for various cellular processes, including signal transduction, cell proliferation, and apoptosis. Research into GUK1 has gained momentum due to its potential implications in several diseases, particularly cancer, where altered nucleotide metabolism is often observed. By studying GUK1, scientists aim to unravel its role in tumorigenesis and explore its potential as a therapeutic target. Recombinant GUK1 proteins have been generated to facilitate in-depth studies of their enzymatic properties, structural biology, and interactions with small molecules. Additionally, these recombinant proteins serve as valuable tools in high-throughput screening efforts to discover novel inhibitors, which could lead to innovative treatments for diseases associated with dysregulated GUK1 activity. Understanding the structure-function relationship of GUK1 through recombinant proteins can also enhance the development of targeted therapies and provide insight into the biochemical pathways it influences. Thus, the exploration of GUK1 recombinant protein is not only pivotal for fundamental research but also holds promising prospects for clinical applications in treating diseases linked to nucleotide metabolism.











