Analytical Data
-
Gene name
HOXD4
- Application
-
Alternative Names
HHO.C13; homeo box D4; homeobox D4; Homeobox protein HHO.C13; Homeobox protein Hox-4B; Homeobox protein Hox-5.1; Homeobox protein Hox-D4; Hox-4.2; Hox-4.2; mouse; homolog of homeo box X; HOX-5.1; HOX4; HOX4B; HOXD4; HXD4_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09016
-
Expression Region
1-255aa
-
AA Sequence
MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL
-
Molecular Weight
54.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HOXD4 is a member of the Homeobox (HOX) gene family, which plays a critical role in embryonic development and the regulation of gene expression. Located on chromosome 2, HOXD4 is particularly important for the patterning of the vertebrate limbs and the development of various tissues during the ontogeny. Research in recent years has highlighted its involvement in key biological processes, including cell differentiation, proliferation, and apoptosis. The study of HOXD4 recombinant protein is significant because it not only aids in understanding the molecular mechanisms behind congenital limb malformations but also contributes to regenerative medicine and cancer research. By producing a recombinant form of HOXD4, scientists can investigate its functional properties in vitro and in vivo, deciphering how it interacts with other proteins and pathways. Additionally, exploring how HOXD4 modulation affects cellular behavior can lead to insights into therapeutic strategies for conditions associated with aberrations in HOX gene expression. Thus, HOXD4 recombinant protein serves as a valuable tool for elucidating the complexities of developmental biology and its implications in health and disease.
