Analytical Data
-
Gene name
ITGB7
- Application
-
Alternative Names
ITGB7；Integrin beta-7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P26010
-
Expression Region
1-140aa
-
AA Sequence
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSCAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQL
-
Molecular Weight
42.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ITGB7, or Integrin Beta 7, is a critical component of the integrin family, which plays significant roles in cell adhesion, migration, and immune response modulation. This protein specifically interacts with alpha subunits to form integrin heterodimers, primarily expressed in immune cells like T lymphocytes and mucosal epithelial cells. Research into ITGB7 is essential for understanding its involvement in various biological processes, including lymphocyte homing to mucosal tissues and the regulation of inflammation. Abnormalities in ITGB7 expression have been implicated in several autoimmune diseases and inflammatory conditions, highlighting its potential as a therapeutic target. Moreover, recombinant ITGB7 proteins can be utilized in various experimental and therapeutic applications, including studying cell-cell interactions, tissue regeneration, and the development of novel immunotherapies. Understanding the structure and function of recombinant ITGB7 is crucial for developing strategies to manipulate its activity in disease contexts, making it a focus of ongoing studies in immunology and cancer research.
