Analytical Data
-
Gene name
CXCR6
- Application
-
Alternative Names
CXCR6；BONZO；STRL33；TYMSTR；C-X-C chemokine receptor type 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00574
-
Expression Region
1-342aa
-
AA Sequence
MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
-
Molecular Weight
40.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXCR6, a chemokine receptor belonging to the CXC chemokine receptor family, plays a pivotal role in immune response and inflammation by mediating the migration of activated T cells, particularly memory T cells, to sites of tissue damage and viral infections. It is predominantly expressed in lymphocytes, with notable presence in T cells, natural killer (NK) cells, and a subset of dendritic cells. The interaction between CXCR6 and its ligand, CXCL16, is crucial for the recruitment of these immune cells to areas where they are needed for pathogen clearance and tissue repair. Research into CXCR6 has gained momentum due to its involvement in various pathophysiological conditions, including chronic inflammatory diseases, cancer metastasis, and viral infections such as HIV. Understanding the structure and function of CXCR6 through recombinant protein studies can provide insights into its signaling mechanisms, biological functions, and potential as a therapeutic target. The production of CXCR6 recombinant proteins enables detailed investigations into receptor-ligand interactions, cellular signaling pathways, and the development of CXCR6-targeted therapies aimed at modulating immune responses. Moreover, the study of CXCR6 may contribute to novel strategies for enhancing immune responses in patients with immunodeficiencies or for developing cancer immunotherapies, thereby representing a significant area of research in immunology and therapeutic development.
