Analytical Data
-
Gene name
DRD3
- Application
-
Alternative Names
DRD3;D(3) dopamine receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35462
-
Expression Region
1-400aa
-
AA Sequence
MASLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTVCSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
-
Molecular Weight
44.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Dopamine receptor D3 (DRD3) is a crucial member of the D2-like dopamine receptor family that plays a significant role in the central nervous system, particularly in modulating dopamine signaling related to mood, cognition, and reward pathways. Its involvement in various neuropsychiatric disorders, including schizophrenia, depression, and drug addiction, makes it a target of intensive research. The study of DRD3 has been hampered by challenges in obtaining sufficient quantities of functional receptor protein for structural and biochemical analyses. Recombinant protein techniques have emerged as valuable tools in this context, allowing scientists to produce DRD3 in heterologous systems such as bacteria, yeast, or mammalian cells. By using these methodologies, researchers can better understand the receptor's structure-function relationships, investigate its interactions with ligands and signaling partners, and potentially discover innovative therapeutic agents that specifically target DRD3. Moreover, studying the recombinant DRD3 protein facilitates high-throughput screening and provides insight into receptor activation mechanisms, which are critical for the development of drugs aimed at modulating dopaminergic pathways. As our understanding of DRD3 expands through recombinant protein studies, it holds promise for advancing treatment strategies for various dopamine-related disorders and enhancing our grasp of its physiological roles in the brain.











