Cat: PA1000-1324

Recombinant Human GPX2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GPX2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GPX2;Glutathione peroxidase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P18283

  • Expression Region

    1-190aa

  • AA Sequence

    MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GPX2, or Glutathione Peroxidase 2, is a pivotal antioxidant enzyme that plays a crucial role in the cellular defense against oxidative stress. It is a member of the larger glutathione peroxidase family, which is essential for reducing peroxides and protecting cells from damage caused by reactive oxygen species (ROS). The study of GPX2 recombinant protein has gained significant interest due to its implications in various physiological and pathological processes, including cancer, inflammation, and neurodegenerative diseases. Elevated levels of GPX2 have been observed in certain types of tumors, suggesting its potential role in tumor progression and resistance to therapy. Additionally, GPX2 is implicated in gut health, where it contributes to intestinal epithelial integrity and immune function. By producing recombinant GPX2, researchers aim to better understand its structure-function relationships, enzyme kinetics, and interactions with other cellular components. This knowledge could lead to the development of novel therapeutic strategies targeting oxidative stress-related diseases. Furthermore, recombinant GPX2 can serve as a valuable tool in biochemical assays and therapeutic applications, as it enables the study of antioxidant mechanisms and potential interventions in oxidative damage. Understanding the functional characteristics of GPX2 through recombinant techniques is thus pivotal for advancing our comprehension of its biological significance and therapeutic potential in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US