Cat: PA2000-4165

Recombinant Human srtA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    srtA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    srtA;Sortase A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9S446

  • Expression Region

    26-206aa

  • AA Sequence

    MHHHHHHKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKD KSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIA GHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGV LDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK

  • Molecular Weight

    27 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The SrtA protein, known as sortase A, is a transpeptidase enzyme found in various Gram-positive bacteria, where it plays a crucial role in anchoring surface proteins to the bacterial cell wall through a process called sortase-mediated protein sorting. This enzyme facilitates the covalent attachment of substrate proteins, which often include virulence factors, to peptidoglycan, thereby influencing bacterial morphology, adherence, and pathogenicity. Understanding the function and mechanism of SrtA is vital for the development of novel antibacterial strategies, especially in the context of rising antibiotic resistance. Research into SrtA often involves the study of its structure-function relationships, enzyme kinetics, and potential inhibitors, aiming to shed light on its role in bacterial infections and providing insights for therapeutic interventions. Additionally, SrtA has garnered interest in biotechnology, particularly in protein engineering and the design of vaccine candidates, due to its ability to customize the presentation of antigens on bacterial surfaces. This multifaceted significance makes SrtA an important target in the fields of microbiology, immunology, and therapeutic development, motivating ongoing investigations into its properties and applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US