Cat: PA1000-1292

Recombinant Human GNG12 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GNG12

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GNG12;Guanine nucleotide-binding Protein G(I)/G(S)/G(O) subunit gamma-12

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UBI6

  • Expression Region

    1-69aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSSKTASTNNIAQARRTVQQLRLEASI ERIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTC

  • Molecular Weight

    10 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GNG12 (Guanine nucleotide-binding protein G (i) subunit gamma-12) is a member of the G-protein gamma subunit family, which plays a crucial role in the signaling pathways mediated by G-protein-coupled receptors (GPCRs). These receptors are vital for numerous physiological processes, including sensory perception, immune response, and cell communication. The GNG12 subunit is involved in the formation of G-protein complexes that transmit signals from extracellular stimuli to intracellular effector pathways. Recent studies have highlighted the significance of GNG12 in various diseases, including cancer and neurological disorders, where dysregulation of GPCR signaling can lead to aberrant cellular functions. As a result, the investigation of GNG12 as a potential therapeutic target has gained momentum. To facilitate this research, the production of recombinant GNG12 protein is critical for biochemical assays and structural studies. Understanding the molecular mechanisms by which GNG12 interacts with other G-protein subunits and receptors will provide insights into its functional roles and may lead to the development of new therapeutic strategies. Through advanced biotechnological methods, including gene cloning and expression systems, researchers are now able to obtain high-purity recombinant GNG12, paving the way for comprehensive studies on its structure and function in cellular signaling.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US