Analytical Data
-
Gene name
GNG12
- Application
-
Alternative Names
GNG12;Guanine nucleotide-binding Protein G(I)/G(S)/G(O) subunit gamma-12
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBI6
-
Expression Region
1-69aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMSSKTASTNNIAQARRTVQQLRLEASI ERIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTC
-
Molecular Weight
10 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GNG12 (Guanine nucleotide-binding protein G (i) subunit gamma-12) is a member of the G-protein gamma subunit family, which plays a crucial role in the signaling pathways mediated by G-protein-coupled receptors (GPCRs). These receptors are vital for numerous physiological processes, including sensory perception, immune response, and cell communication. The GNG12 subunit is involved in the formation of G-protein complexes that transmit signals from extracellular stimuli to intracellular effector pathways. Recent studies have highlighted the significance of GNG12 in various diseases, including cancer and neurological disorders, where dysregulation of GPCR signaling can lead to aberrant cellular functions. As a result, the investigation of GNG12 as a potential therapeutic target has gained momentum. To facilitate this research, the production of recombinant GNG12 protein is critical for biochemical assays and structural studies. Understanding the molecular mechanisms by which GNG12 interacts with other G-protein subunits and receptors will provide insights into its functional roles and may lead to the development of new therapeutic strategies. Through advanced biotechnological methods, including gene cloning and expression systems, researchers are now able to obtain high-purity recombinant GNG12, paving the way for comprehensive studies on its structure and function in cellular signaling.
