Analytical Data
-
Gene name
CXCR3
- Application
-
Alternative Names
CXCR3；GPR9；C-X-C chemokine receptor type 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49682
-
Expression Region
121-220aa
-
AA Sequence
SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTL TCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQL
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXCR3, a chemokine receptor primarily expressed on T cells, plays a crucial role in the immune response by mediating the migration of these cells to sites of inflammation. Its involvement in various physiological and pathological processes, including autoimmune diseases, cancer progression, and infectious diseases, has made it a significant focus of research. The distinct ligands for CXCR3, namely CXCL9, CXCL10, and CXCL11, are key players in directing T cell trafficking and activation. Understanding the structure and function of CXCR3 is critical for developing therapeutic strategies targeting this receptor. Recombinant CXCR3 proteins have been engineered to study the receptor's interactions with its ligands, elucidate downstream signaling pathways, and investigate its role in disease mechanisms. This research is pivotal for exploring potential therapies aimed at modulating CXCR3 activity, which could enhance immune responses in cancer patients or inhibit harmful inflammation in autoimmune diseases. Advances in this field may contribute to the development of receptor antagonists or agonists, opening new avenues for treating various diseases characterized by dysregulated immune responses.
