Analytical Data
-
Gene name
GNAZ
- Application
-
Alternative Names
GNAZ;Guanine nucleotide-binding Protein G(z) subunit alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19086
-
Expression Region
1-355aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGCRQSSEEKEAARRSRRIDRHLRSESQRQ RREIKLLLLGTSNSGKSTIVKQMKIIHSGGFNLEACKEYKPLIIYNAIDS LTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRR LWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRD MTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSG YDLKLYEDNQTSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIR RIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDT SNIQFVFDAVTDVIIQNNLKYIGLC
-
Molecular Weight
43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GNAZ (Guanine Nucleotide-Binding Protein, Alpha Z) is a member of the G protein family, specifically the Gq/11 subfamily, which plays a crucial role in various signaling pathways in mammals. Research on GNAZ has gained momentum due to its involvement in mediating signal transduction from G protein-coupled receptors (GPCRs). These receptors are pivotal in cellular communication and influence a wide range of physiological processes, including neurotransmission, immune responses, and hormonal regulation. GNAZ is predominantly expressed in tissues such as the brain and the cardiovascular system, where it modulates critical functions. Studies suggest that GNAZ is implicated in modulating neurotransmitter release and regulating blood pressure, thereby linking it to neurological and cardiovascular disorders. The investigation of GNAZ's structure and function, particularly through recombinant protein techniques, has provided insights into its mechanism of action and interaction with receptors and downstream effectors. Moreover, the development of GNAZ-targeted therapeutics holds potential for the treatment of diseases associated with dysregulated GPCR signaling. Understanding GNAZ's role could lead to novel strategies for drug development, emphasizing its significance in the fields of pharmacology and cellular biology. As such, ongoing research continues to explore the therapeutic implications of GNAZ modulation in various disease contexts, highlighting its importance in both basic and applied sciences.
