Analytical Data
-
Gene name
HLA-DPA1
- Application
-
Alternative Names
HLA-DPA1; HLA-DP1A; HLASBHLA class II histocompatibility antigen; DP alpha 1 chain; DP(W3); DP(W4); HLA-SB alpha chain; MHC class II DP3-alpha; MHC class II DPA1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20036
-
Expression Region
29-222aa
-
AA Sequence
AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTE
-
Molecular Weight
26.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLA-DPA1, a gene located on chromosome 6, encodes a component of the major histocompatibility complex (MHC) class II molecules, which are crucial for the immune system's ability to present antigens to CD4+ T cells. This protein plays a significant role in immune response, influencing susceptibility to various autoimmune diseases and infections, as well as transplant outcomes. Research on HLA-DPA1 recombinant proteins has gained prominence due to their potential applications in immunotherapy, vaccine development, and biomarker identification for diseases like lupus, rheumatoid arthritis, and certain cancers. Moreover, understanding the structural and functional characteristics of HLA-DPA1 can provide insights into T-cell activation processes and the mechanisms underpinning graft-versus-host disease (GVHD) in transplantation settings. These studies contribute to our overall knowledge of HLA-DPA1’s role in modulating immune responses and may lead to innovative therapeutic strategies aimed at enhancing graft acceptance and preventing immune-mediated diseases. Therefore, the investigation of HLA-DPA1 recombinant proteins not only deepens our understanding of immune system dynamics but also holds promise for advancing clinical applications in personalized medicine.
