Analytical Data
-
Gene name
HLA-C
- Application
-
Alternative Names
1C07_HUMAN; Cw-7 alpha chain; D6S204; HLA class I histocompatibility antigen; HLA class I histocompatibility antigen; C alpha chain; HLA class I histocompatibility antigen; Cw-1 alpha chain; HLA JY3; HLA-C; HLA-C histocompatibility type; HLA-Cw; HLA-JY3; HLAC; HLC C; HLC-C; human leukocyte antigen-C alpha chain; major histocompatibility antigen HLA-C; major histocompatibility complex; class I; C
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10321
-
Expression Region
1-336aa
-
AA Sequence
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAAQITQRKLEASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWAPGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQGPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
-
Molecular Weight
63.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLA-C (Human Leukocyte Antigen-C) is a critical component of the major histocompatibility complex (MHC) class I molecules that play a vital role in the immune response by presenting peptides derived from endogenous proteins to CD8+ T cells. The study of HLA-C recombinant proteins is significant for several reasons. First, HLA-C itself is highly polymorphic, with numerous alleles affecting the immune recognition and response in various populations, which is particularly relevant in contexts such as organ transplantation, autoimmunity, and infectious diseases. Understanding the structure and function of HLA-C can provide insights into how these variations influence T cell activation and immunological outcomes. Moreover, recombinant HLA-C proteins can be used in research to analyze T cell receptor (TCR) interactions, leading to a better understanding of immune mechanisms and potential therapeutic strategies. Additionally, with the rise of personalized medicine, HLA-C typing and profiling for specific diseases can guide the development of tailored immunotherapies. In recent years, advancements in recombinant DNA technology have made it easier to produce these proteins in sufficient quantities for both functional assays and structural studies, facilitating significant progress in this field. Overall, the research on HLA-C recombinant proteins is essential for enhancing our comprehension of immune responses and for developing better interventions in immunological diseases.
