Analytical Data
-
Gene name
GNAI2
- Application
-
Alternative Names
GNAI2;GNAI2B;Guanine nucleotide-binding Protein G(i) subunit alpha-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04899-2
-
Expression Region
1-339aa
-
AA Sequence
MEYAGHLPASSAQGTILACTSCTGAGESGKSTIVKQMKIIHEDGYSEEEC RQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEE QGVLPDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQS DYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCF EGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSII LFLNKKDLFEEKITHSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKD TKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
-
Molecular Weight
63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GNAI2, a member of the G protein alpha subunit family, plays a crucial role in various cellular signaling pathways by acting as a molecular switch in response to G protein-coupled receptor (GPCR) activation. Researchers have increasingly focused on GNAI2 due to its involvement in numerous physiological processes, including neurotransmission, hormone response, and cell proliferation. Mutations and dysregulation of GNAI2 have been implicated in several diseases, such as cancer, cardiovascular disorders, and neurological conditions. To better understand its function and therapeutic potential, studies on the recombinant expression of GNAI2 have become essential. Recombinant GNAI2 proteins allow for in-depth analysis of their structural characteristics, binding affinity, and interaction with other signaling partners. Such research not only elucidates the fundamental mechanisms of GNAI2 but also opens avenues for drug development targeting GPCR pathways. Moreover, the ability to produce GNAI2 in a laboratory setting facilitates the exploration of innovative treatment options for GNAI2-related diseases, highlighting the importance of this research in advancing biomedical science. Overall, the study of GNAI2 recombinant proteins is pivotal for unraveling its roles in health and disease, potentially leading to novel therapeutic strategies.
