Analytical Data
-
Gene name
PLAP
- Application
-
Alternative Names
PLAP；PLAP；Phospholipase A-2-activating Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05187
-
Expression Region
117-447aa
-
AA Sequence
TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV
-
Molecular Weight
41.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLAP (placental alkaline phosphatase) is a heat-stable enzyme primarily expressed in the human placenta, and it plays a crucial role in various physiological processes, including dephosphorylation reactions essential for nutrient absorption and fetal development. Research on PLAP has gained considerable attention due to its potential applications in medical diagnostics and therapeutics, particularly in cancer research, where its expression is often observed in certain tumor types. The recombinant production of PLAP using molecular biology techniques has facilitated the study of its structure-function relationships and biological activities. Advances in protein engineering and expression systems, such as bacterial or eukaryotic cell lines, have enabled the generation of large quantities of active PLAP, which can be used for enzyme activity assays, antibody production, and as a diagnostic marker in various diseases. Furthermore, understanding the mechanisms of PLAP enzymatic action may pave the way for novel therapeutic strategies targeting diseases characterized by abnormal ALP activity. Overall, the study of recombinant PLAP represents a promising avenue for advancing both fundamental and applied biomedical research.
