Cat: PA2000-48DB

Recombinant Human HCII Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HCII

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HCII;HCF2;Heparin cofactor 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P05546

  • Expression Region

    20-499aa

  • AA Sequence

    GSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFHKENTVTNDW IPEGEEDDDYLDLEKIFSEDDDYIDIVDSLSVSPTDSDVSAGNILQLFHG KSRIQRLNILNAKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGL KGETHEQVHSILHFKDFVNASSKYEITTIHNLFRKLTHRLFRRNFGYTLR SVNDLYIQKQFPILLDFKTKVREYYFAEAQIADFSDPAFISKTNNHIMKL TKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNERE VVKVSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTL EAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFD KNGNMAGISDQRIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQVRF TVDRPFLFLIYEHRTSCLLFMGRVANPSRS

  • Molecular Weight

    56 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of HCII (Heparin Cofactor II) recombinant proteins has gained significant attention in the field of biomedical research, particularly due to their vital role in the regulation of anticoagulation mechanisms in the human body. HCII is a serine protease inhibitor that plays a critical role in the modulation of thrombin activity, an essential enzyme in the blood coagulation cascade. The ability of HCII to bind to heparin enhances its inhibitory effect on thrombin, making it a key target in understanding and treating thrombotic disorders. Furthermore, recombinant techniques allow for the production of HCII variants with enhanced properties, facilitating the exploration of their therapeutic potential in conditions such as deep vein thrombosis and pulmonary embolism. The advancement of genetic engineering and protein expression technologies has enabled researchers to investigate the structure-function relationships of HCII, paving the way for the development of innovative anticoagulant therapies. This research not only holds promise for improving patient outcomes in coagulation-related diseases but also contributes to the broader understanding of protein interactions involved in the hemostatic response. As such, the study of HCII recombinant proteins stands at the intersection of biochemistry, pharmacology, and clinical medicine, addressing critical challenges in the management of thrombotic diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US