Cat: PA2000-36DB

Recombinant Human FABP8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FABP8

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FABP8;Myelin P2 Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P02689

  • Expression Region

    1-132aa

  • AA Sequence

    MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

  • Molecular Weight

    41.9kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fatty acid-binding protein 8 (FABP8), also known as Ap2 or mal1, is a member of the fatty acid-binding protein family, which plays a crucial role in the uptake, transport, and storage of long-chain fatty acids within cellular compartments. Research on FABP8 has gained traction due to its significant involvement in various physiological and pathological processes, including lipid metabolism, inflammation, and cellular signaling. Elevated levels of FABP8 have been associated with metabolic disorders such as obesity and diabetes, as well as neurodegenerative diseases like Alzheimer's. The recombinant expression of FABP8 has become a focus for understanding its structure-function relationship and the potential for therapeutic interventions. By producing FABP8 in a recombinant system, researchers aim to obtain sufficient quantities of the protein for biochemical and biophysical studies, including examining ligand binding, protein-protein interactions, and the modulation of its activity under different biochemical conditions. Ultimately, insights gained from these studies could lead to the development of novel strategies for managing metabolic diseases and designing drugs targeting FABP8 to modulate its function in various cellular contexts. The continued investigation of FABP8 is expected to enhance our understanding of fat metabolism and its broader implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US