Analytical Data
-
Gene name
FABP8
- Application
-
Alternative Names
FABP8;Myelin P2 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02689
-
Expression Region
1-132aa
-
AA Sequence
MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
-
Molecular Weight
41.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fatty acid-binding protein 8 (FABP8), also known as Ap2 or mal1, is a member of the fatty acid-binding protein family, which plays a crucial role in the uptake, transport, and storage of long-chain fatty acids within cellular compartments. Research on FABP8 has gained traction due to its significant involvement in various physiological and pathological processes, including lipid metabolism, inflammation, and cellular signaling. Elevated levels of FABP8 have been associated with metabolic disorders such as obesity and diabetes, as well as neurodegenerative diseases like Alzheimer's. The recombinant expression of FABP8 has become a focus for understanding its structure-function relationship and the potential for therapeutic interventions. By producing FABP8 in a recombinant system, researchers aim to obtain sufficient quantities of the protein for biochemical and biophysical studies, including examining ligand binding, protein-protein interactions, and the modulation of its activity under different biochemical conditions. Ultimately, insights gained from these studies could lead to the development of novel strategies for managing metabolic diseases and designing drugs targeting FABP8 to modulate its function in various cellular contexts. The continued investigation of FABP8 is expected to enhance our understanding of fat metabolism and its broader implications in health and disease.











