Cat: PA2000-8232

Recombinant Human HEXIM2 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HEXIM2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Hexamethylene bis-acetamide-inducible protein 2; Hexamthylene bis-acetamide inducible 2 ; HEXI2_HUMAN; hexim 2; HEXIM2; L3; Protein HEXIM2

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96MH2

  • Expression Region

    1-286aa

  • AA Sequence

    MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSRSPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAPYNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT

  • Molecular Weight

    58.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HEXIM2 (HIV-1 Tat interactive protein 2) is a key regulator of various cellular processes, particularly in the context of transcriptional regulation and cellular response to oxidative stress. Initially identified as a protein that interacts with the HIV-1 Tat protein, HEXIM2 has been shown to play a critical role in modulating the activity of positive transcription elongation factor b (P-TEFb), which is essential for the transition of RNA polymerase II from transcription initiation to elongation. Research has highlighted its significance in several physiological and pathological contexts, including its involvement in cancer, neuronal development, and immune responses. The therapeutic potential of targeting HEXIM2 has garnered interest, as its modulation could influence the expression of genes involved in cell proliferation and apoptosis. The expression and functional analysis of recombinant HEXIM2 protein have been essential in elucidating its mechanisms of action. This research not only aids in understanding the basic biological functions of HEXIM2 but also paves the way for developing novel therapeutic strategies for diseases linked to dysregulated transcriptional control. By studying the reconstituted protein's interactions and functional impacts in various cellular assays, researchers aim to further define its roles and explore its potential as a drug target in conditions characterized by aberrant transcriptional regulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US