Analytical Data
-
Gene name
HESX1
- Application
-
Alternative Names
HESX1; HANF; Homeobox expressed in ES cells 1; Homeobox protein ANF; hAnf
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBX0
-
Expression Region
1-185aa
-
AA Sequence
MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE
-
Molecular Weight
47.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HESX1, a member of the Hes family of genes, encodes a transcriptional repressor implicated in various developmental processes, particularly in the formation of the anterior pituitary gland and the central nervous system. Dysregulation of HESX1 has been associated with several congenital disorders, including septo-optic dysplasia and other midline malformations. Given its essential role in embryonic development and its impact on pituitary function, researchers have focused on the recombinant expression of HESX1 protein to better understand its biological functions and regulatory mechanisms. The study of HESX1 recombinant protein aims to elucidate its interaction with other signaling pathways and transcription factors that govern cell fate decisions during early embryogenesis. Furthermore, characterizing the structure and function of HESX1 can provide insights into potential therapeutic strategies for conditions arising from its dysfunction. Current methodologies involve utilizing advanced techniques such as recombinant DNA technology and protein purification to produce HESX1 in heterologous systems, facilitating in vitro assays to assess its biochemical properties and effects on gene expression. Overall, HESX1 recombinant protein studies represent a significant step towards unraveling the complexities of developmental biology and its associated pathologies.
