Analytical Data
-
Gene name
COL4a1
- Application
-
Alternative Names
COL4a1；Collagen alpha-1(IV) chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02462
-
Expression Region
30-167aa
-
AA Sequence
GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP
-
Molecular Weight
39.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COL4A1, a member of the collagen family, is critical for the structural integrity of basal membranes in various tissues. Mutations in the COL4A1 gene have been linked to several vascular and neurological disorders, including familial encephalopathy with endothelial dysfunction and porencephaly, highlighting its essential role in maintaining both the structural and functional properties of blood vessels and the central nervous system. The study of recombinant COL4A1 proteins has gained significant traction as it allows researchers to explore the functional implications of different mutations and their impact on protein assembly, stability, and interactions. By generating and purifying recombinant COL4A1, scientists can carry out biophysical and biochemical analyses, providing insights into the molecular mechanisms underlying the pathologies associated with COL4A1 mutations. Additionally, understanding the structure-function relationship of COL4A1 can pave the way for potential therapeutic strategies aimed at correcting or compensating for the defects caused by these mutations. Overall, the research on COL4A1 recombinant proteins is pivotal in elucidating the pathophysiology of related diseases and could facilitate the development of targeted therapies to improve patient outcomes.
