Analytical Data
-
Gene name
Tlr11
- Application
-
Alternative Names
Tlr11；Gm287；Tlr12；Toll-like receptor 11
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6R5P0
-
Expression Region
769-926aa
-
AA Sequence
RGQFNYDVFISYCEEDQAWVLEELVPVLEKAPPEGEGLRLCLPARDFGIGNDRMESMIASMGKSRATLCVLTGQALASPWCNLELRLATYHLVARPGTTHLLLLFLEPLDRQRLHSYHRLSRWLQKEDYFDLSQGKVEWNSFCEQLKRRLSKAGQERD
-
Molecular Weight
25.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Toll-like receptor 11 (TLR11) is a member of the Toll-like receptor family, which plays a crucial role in the innate immune system by recognizing pathogen-associated molecular patterns. Research has shown that TLR11 is primarily expressed in the urinary tract and has a significant role in the detection of uropathogenic Escherichia coli. It is also involved in the immune response to certain protozoan infections, such as those caused by Toxoplasma gondii and other pathogens. Despite its importance, the biological mechanisms underlying TLR11 signaling and its potential implications in disease management have not been fully elucidated. Developing recombinant TLR11 proteins has become a focal point in research, enabling scientists to investigate its signaling pathways, ligand interactions, and functional relevance in immune responses. The expression and purification of TLR11 in a recombinant form provide tools for detailed immunological studies and the potential for therapeutic applications, such as vaccine development and enhancement of anti-infective strategies. Understanding TLR11’s role may pave the way for innovative approaches to manipulate the immune response in various infectious and inflammatory diseases, highlighting the necessity for ongoing research in this area.
