Cat: PA2000-4035

Recombinant Human SLC7A5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLC7A5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLC7A5;MDU1;Amino acid transporter heavy chain SLC3A2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q01650

  • Expression Region

    16-50aa

  • AA Sequence

    AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI

  • Molecular Weight

    18.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLC7A5, also known as LAT1 (L-type amino acid transporter 1), is a crucial membrane protein that facilitates the transport of large neutral amino acids across cell membranes, playing a significant role in various physiological processes, including nutrient absorption, cell growth, and metabolism. Its importance has been underscored by emerging research linking altered SLC7A5 expression to various pathological conditions, such as cancer, neurodegenerative diseases, and metabolic disorders. For instance, in many cancer types, increased SLC7A5 expression correlates with enhanced tumor growth and resistance to therapies, leading to its investigation as a potential therapeutic target. The analysis of SLC7A5 functions and interactions at the molecular level has necessitated the development of recombinant protein constructs, enabling detailed studies of its structure, transport mechanisms, and regulatory pathways. By producing and purifying SLC7A5 as a recombinant protein, researchers aim to elucidate the specific amino acid transport dynamics, identify interaction partners, and explore the effects of post-translational modifications on its function. The study of SLC7A5 as a recombinant protein not only provides insights into its biological roles but also holds potential for the development of novel therapeutic strategies targeting amino acid transport in disease contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US