Cat: PA2000-4033

Recombinant E.coli FimF41a Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FimF41a

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FimF41a;F41 fimbrial Protein

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11900

  • Expression Region

    23-277aa

  • AA Sequence

    ADWTEGQPGDIIIGGEITSPSVKWLWKTGEGLSSFSNTTNEIVKRKLNISVPTDELFLAAKMSDGIKGVFVGNTLIPKIEMASYDGSVITPSFTSNTAMDIAVKVKNSGDNTELGTLSVPLSFGAAVATIFDGDTTDSAVAHIIGGSAGTVFEGLVNPGRFTDQNIAYKWNGLSKAEMAGYVEKLMPGQSASTSYSGFHNWDDLSHSNYTSANKASYLSYGSGVSAGSTLVMNLNKDVAGRLEWVAPVTITVIYS

  • Molecular Weight

    34.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FimF41a is a recombinant protein that has garnered significant attention in the field of microbiology and molecular biology due to its potential applications in understanding bacterial adhesion mechanisms. The discovery of FimF41a, a fimbrial adhesin derived from certain pathogenic strains of Escherichia coli, stems from the growing need to combat bacterial infections that frequently arise from biofilm formation on host tissues and medical devices. Fimbriae play a crucial role in the initial adhesion of bacteria to surfaces, facilitating colonization and subsequent infection. Research into FimF41a focuses on its structure, function, and interactions with host cells, which can elucidate the molecular basis of bacterial adherence. By recombinantly expressing this protein, scientists aim to study its biophysical properties and pathogenic potential in vitro, providing insights that could lead to the development of novel therapeutic strategies or vaccines targeting bacterial infections. Moreover, understanding the immunogenicity of FimF41a may also contribute to the design of diagnostic tools or anti-adhesive treatments that can prevent bacterial colonization. Overall, the research on FimF41a not only enhances our fundamental knowledge of bacterial physiology but also holds promise for significant clinical applications in controlling and preventing infectious diseases associated with biofilm-forming bacteria.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US