Analytical Data
-
Gene name
GAL1
- Application
-
Alternative Names
GAL1;GALK;Galactokinase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09382
-
Expression Region
2-135aa
-
AA Sequence
ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFN AHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKL PDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GAL1 protein, also known as Galactokinase 1, plays a crucial role in galactose metabolism, converting galactose into galactose-1-phosphate, a critical step in the Leloir pathway. This pathway is essential for organisms that utilize galactose as a carbohydrate source, making GAL1 significant in both physiological and biochemical contexts. Mutations in the GAL1 gene can lead to galactosemia, a hereditary disorder that results in the accumulation of galactose in the body, leading to severe health issues, including liver damage, cataracts, and cognitive impairments. The study of recombinant GAL1 protein has garnered attention as it can provide insights into enzyme structure-function relationships, substrate specificity, and the effects of mutations associated with galactosemia. By utilizing techniques such as cloning, expression, and purification of the GAL1 gene, researchers can create a model to better understand its biochemical properties and interactions. Furthermore, understanding GAL1's function at a molecular level can pave the way for potential therapeutic interventions for galactosemia and enhance our broader understanding of carbohydrate metabolism in different organisms. The recombinant protein may also offer valuable applications in industrial biotechnology, where enzyme engineering could optimize processes involving galactose metabolism. Consequently, the investigation of GAL1 not only contributes to fundamental biological knowledge but also holds promise for medical and industrial advancements.











