Cat: PA1000-1185

Recombinant Human GAL1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GAL1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GAL1;GALK;Galactokinase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09382

  • Expression Region

    2-135aa

  • AA Sequence

    ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFN AHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKL PDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD

  • Molecular Weight

    15 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GAL1 protein, also known as Galactokinase 1, plays a crucial role in galactose metabolism, converting galactose into galactose-1-phosphate, a critical step in the Leloir pathway. This pathway is essential for organisms that utilize galactose as a carbohydrate source, making GAL1 significant in both physiological and biochemical contexts. Mutations in the GAL1 gene can lead to galactosemia, a hereditary disorder that results in the accumulation of galactose in the body, leading to severe health issues, including liver damage, cataracts, and cognitive impairments. The study of recombinant GAL1 protein has garnered attention as it can provide insights into enzyme structure-function relationships, substrate specificity, and the effects of mutations associated with galactosemia. By utilizing techniques such as cloning, expression, and purification of the GAL1 gene, researchers can create a model to better understand its biochemical properties and interactions. Furthermore, understanding GAL1's function at a molecular level can pave the way for potential therapeutic interventions for galactosemia and enhance our broader understanding of carbohydrate metabolism in different organisms. The recombinant protein may also offer valuable applications in industrial biotechnology, where enzyme engineering could optimize processes involving galactose metabolism. Consequently, the investigation of GAL1 not only contributes to fundamental biological knowledge but also holds promise for medical and industrial advancements.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US