Cat: PA1000-1184

Recombinant Human GALE Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GALE

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GALE;UDP-glucose 4-epimerase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14376

  • Expression Region

    1-348aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAEKVLVTGGAGYIGSHTVLELLEAGYLPV VIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKY SFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFS SSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNA VLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDY DTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQM VQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMC EDLWRWQKQNPSGFGTQA

  • Molecular Weight

    40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GALE (UDP-galactose 4-epimerase) is a crucial enzyme in the galactose metabolism pathway, responsible for catalyzing the interconversion of UDP-galactose and UDP-glucose. Deficiency in GALE activity can lead to disorders such as galactosemia, characterized by an inability to properly metabolize galactose, resulting in serious health complications such as liver damage, cognitive impairment, and developmental delays. Research into GALE recombinant proteins has gained momentum due to their potential applications in gene therapy, biotechnology, and metabolic engineering. By producing functional GALE proteins through recombinant DNA technology, researchers can delve into enzyme kinetics, structure-function relationships, and potential therapeutic interventions for metabolic disorders. Additionally, understanding GALE’s structure through techniques such as X-ray crystallography and NMR spectroscopy has provided insights into substrate specificity and regulatory mechanisms. Enhanced characterization of GALE not only aids in the development of treatments for galactosemia but also contributes to the broader understanding of carbohydrate metabolism, enabling advancements in dietary supplements and interventions for microbial production of galactose-derived compounds. The exploration of GALE recombinant proteins thus holds significant promise for both fundamental biological research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US