Analytical Data
-
Gene name
HAN11
- Application
-
Alternative Names
AN11; Dcaf7; DCAF7_HUMAN; DDB1- and CUL4-associated factor 7; HAN11 ; Human anthocyanin; Petunia; Seven WD repeat protein of the AN11 family 1; SWAN 1; WD repeat domain 68; WD repeat protein An11 homolog ; WD repeat-containing protein 68; WD repeat-containing protein An11 homolog; WDR68
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61962
-
Expression Region
1-342aa
-
AA Sequence
MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV
-
Molecular Weight
54.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the HAN11 recombinant protein is rooted in the increasing interest in understanding the functions and mechanisms of various proteins, particularly those involved in biological processes such as cell signaling, immune response, and protein interactions. HAN11, derived from a specific organism or cell line, presents unique structural and functional characteristics that make it a valuable subject for research. Its potential applications range from biotechnology to therapeutic development, particularly in the context of diseases where protein dysfunction is involved. Moreover, the expression and purification of recombinant proteins like HAN11 enable the exploration of their biochemical properties, interactions with other molecules, and roles in cellular pathways. The investigation of HAN11 also contributes to the broader understanding of protein dynamics and functionality, which can lead to innovations in drug design, diagnostic tools, and therapeutic strategies. Researchers aim to elucidate the specific mechanisms by which HAN11 exerts its effects, including how it may influence cellular behavior or contribute to disease pathology, ultimately paving the way for potential clinical applications. The study of HAN11 not only enhances our fundamental knowledge of protein biology but also holds promise for practical applications in medicine and biotechnology, making it a focal point for ongoing research efforts.











