Analytical Data
-
Gene name
HBD
- Application
-
Alternative Names
HBD;Hemoglobin subunit delta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02042
-
Expression Region
2-147aa
-
AA Sequence
VHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH
-
Molecular Weight
47.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HBD (Human Defensin Beta) recombinant proteins have garnered significant attention in recent years due to their crucial role in the innate immune response and potential therapeutic applications. Human defensins are small, cationic peptides that exhibit antimicrobial activity against a broad range of pathogens, including bacteria, viruses, and fungi. The increasing prevalence of antibiotic-resistant infections has highlighted the need for alternative antimicrobial agents, positioning HBDs as promising candidates for drug development. Research has shown that HBDs not only directly kill microbes but also modulate immune responses, indicating their multifaceted role in host defense mechanisms. Additionally, advancements in recombinant DNA technology have facilitated the production of HBDs, allowing for large-scale synthesis and detailed studies of their structure-function relationships. These developments have led to ongoing investigations into the therapeutic potential of HBDs in areas such as wound healing, respiratory diseases, and chronic inflammatory conditions. Understanding the mechanisms underlying the activity of HBDs and optimizing their delivery systems could significantly enhance their efficacy as novel therapeutics, paving the way for innovative treatments that address urgent public health challenges.











