Cat: PA1000-1141

Recombinant Human FN3KRP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FN3KRP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FN3KRP;Ketosamine-3-kinase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HA64

  • Expression Region

    1-309aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMEELLRRELGCSSVRATGHSGGGCISQ GRSYDTDQGRVFVKVNPKAEARRMFEGEMASLTAILKTNTVKVPKPIKVL DAPGGGSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGT VGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQM DMVEKESGDREALQLWSALQLKIPDLFRDLEIIPALLHGDLWGGNVAEDS SGPVIFDPASFYGHSEYELAIAGMFGGFSSSFYSAYHGKIPKAPGFEKRL QLYQLFHYLNHWNHFGSGYRGSSLNIMRNLVK

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FN3KRP, or Fructose-Base Protein Kinase Regulating Protein, is a novel protein that has garnered increasing attention due to its role in regulating biological processes associated with fructose metabolism. This protein is part of the fructosamine-3-kinase (FN3K) family, which is implicated in the modification of proteins through glycation, a process where sugars bind to proteins, affecting their structure and function. Research suggests that FN3KRP may play a critical role in cellular responses to high-fructose diets, which have been linked to various metabolic disorders, including obesity, diabetes, and cardiovascular diseases. Understanding FN3KRP's function could provide insights into the pathological effects of fructose and offer potential therapeutic targets for treating these conditions. Scientists are currently exploring its expression patterns, enzymatic activity, and interaction networks to better elucidate its biological significance and potential applications in medicine. As the prevalence of fructose in diets increases globally, the study of FN3KRP could contribute to a deeper understanding of metabolic health and disease prevention strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US