Cat: PA1000-1133

Recombinant Human FKBP1B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FKBP1B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FKBP1B;FKBP12.6;FKBP1L;Peptidyl-prolyl cis-trans isomerase FKBP1B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P68106

  • Expression Region

    1-108aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHRSMGVEIETISPGDGRTFPKKGQTCVVHYT GMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCT PDVAYGATGHPGVIPPNATLIFDVELLNLE

  • Molecular Weight

    14 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FKBP1B, or FK506-binding protein 1B, is a member of the FKBP family of immunophilins that serves as a peptidyl-prolyl cis-trans isomerase, facilitating protein folding and regulation within cells. This protein has garnered significant interest due to its role in critical biological processes such as immune response, cell signaling, and apoptosis. Research has highlighted its involvement in various diseases, including cancer and neurodegenerative disorders, indicating that FKBP1B may hold therapeutic potential. The recombinant production of FKBP1B enables detailed studies into its structure-function relationship, post-translational modifications, and interactions with other proteins. Utilizing advanced techniques in molecular cloning and expression systems, scientists aim to generate high yields of functional FKBP1B for use in biochemical assays and structural biology. Furthermore, understanding FKBP1B's mechanism of action may open new avenues for drug design, targeting its interaction pathways. As a result, FKBP1B recombinant protein research is pivotal for elucidating its biological significance and potential applications in medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US