Analytical Data
-
Gene name
hmw1
- Application
-
Alternative Names
hmw1；Cytadherence high molecular weight Protein 1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q50365
-
Expression Region
1-139aa
-
AA Sequence
MKKSKEAVFEDKDYTEENPEQIFGNLYDGKLTVQDGKVKIAYDGDGNGYYIAFNSETGVYYDPYGDTEYDISVLFDANGNSFVFADAPTVEVLAGEQEQTEAEPDYLQYVGNEAYGYYDEAGEWVWSGY
-
Molecular Weight
22.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HMW1, or high molecular weight protein 1, is a significant protein involved in various biological processes, particularly in the context of cell adhesion, migration, and the immune response. Its study has gained attention due to its potential implications in cancer research, where alterations in its expression may influence tumor progression and metastasis. The understanding of HMW1's structure and function is crucial for elucidating its role in pathology. Researchers have been focusing on recombinant techniques to produce HMW1 to study its properties in detail, as native expression can be low and variable. Recombinant HMW1 can be utilized to develop assays to explore its interactions with other cellular components and to assess its functions in vitro and in vivo. Additionally, the generated protein can serve as a valuable tool for the development of therapeutic strategies and diagnostic markers in diseases where HMW1 is implicated. Ongoing research aims to elucidate the molecular mechanisms by which HMW1 contributes to cellular behavior and disease states, highlighting the importance of continued investigation into this multifunctional protein.
