Analytical Data
-
Gene name
FDX1
- Application
-
Alternative Names
FDX1;ADX;Adrenodoxin. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10109
-
Expression Region
61-184aa
-
AA Sequence
SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
-
Molecular Weight
21.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FDX1, or ferredoxin 1, is an important electron carrier involved in various biological processes, particularly in mitochondrial and plastidic electron transport chains. It plays a crucial role in cellular metabolism, including the biosynthesis of steroid hormones and the metabolism of fatty acids. Research on FDX1 recombinant proteins has garnered significant interest due to their potential applications in biotechnology and medicine. Recombinant FDX1 can be utilized as a tool for studying electron transfer mechanisms, understanding metabolic pathways, and developing novel therapeutic strategies targeting metabolic disorders. Furthermore, the ability to produce FDX1 in a controlled recombinant system enhances the understanding of its structure-function relationship, enabling the design of more effective enzymes for industrial processes. Recent studies have also highlighted the potential of FDX1 in enhancing plant stress tolerance, which could be leveraged in agricultural biotechnology. Given its pivotal role in electron transport and metabolic regulation, the study of FDX1 and its recombinant forms continues to be a vibrant field of research with implications spanning from fundamental biology to applied sciences. As researchers delve deeper into characterizing FDX1 and its interactions within cellular systems, the unlocking of its full potential may lead to breakthroughs in both health and agriculture.











