Cat: PA1000-1110

Recombinant Human FDX1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FDX1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FDX1;ADX;Adrenodoxin. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10109

  • Expression Region

    61-184aa

  • AA Sequence

    SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

  • Molecular Weight

    21.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FDX1, or ferredoxin 1, is an important electron carrier involved in various biological processes, particularly in mitochondrial and plastidic electron transport chains. It plays a crucial role in cellular metabolism, including the biosynthesis of steroid hormones and the metabolism of fatty acids. Research on FDX1 recombinant proteins has garnered significant interest due to their potential applications in biotechnology and medicine. Recombinant FDX1 can be utilized as a tool for studying electron transfer mechanisms, understanding metabolic pathways, and developing novel therapeutic strategies targeting metabolic disorders. Furthermore, the ability to produce FDX1 in a controlled recombinant system enhances the understanding of its structure-function relationship, enabling the design of more effective enzymes for industrial processes. Recent studies have also highlighted the potential of FDX1 in enhancing plant stress tolerance, which could be leveraged in agricultural biotechnology. Given its pivotal role in electron transport and metabolic regulation, the study of FDX1 and its recombinant forms continues to be a vibrant field of research with implications spanning from fundamental biology to applied sciences. As researchers delve deeper into characterizing FDX1 and its interactions within cellular systems, the unlocking of its full potential may lead to breakthroughs in both health and agriculture.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US