Cat: PA1000-1103

Recombinant Human FCGR2B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FCGR2B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FCGR2B;CD32;FCG2;Low affinity immunoglobulin gamma Fc region receptor II-b

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P31994

  • Expression Region

    46-217aa

  • AA Sequence

    APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHT QPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEG ETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYH CTGNIGYTLYSSKPVTITVQAP

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FCGR2B (Fc gamma receptor IIb) is a key inhibitory receptor primarily expressed on the surface of B cells, monocytes, and other immune cells. It plays a critical role in modulating immune responses by regulating antibody production, phagocytosis, and the activation of immune cells. Dysregulation of FCGR2B has been implicated in various autoimmune diseases, infections, and cancers, making it a significant target for therapeutic intervention. Research into recombinant FCGR2B proteins has gained momentum due to their potential in understanding the mechanisms of immune regulation and their applications in immunotherapy. By studying these recombinant proteins, scientists aim to elucidate the receptor's structure-function relationship, examine its role in ligand binding, and assess its impact on cellular signaling pathways. Additionally, FCGR2B's involvement in antibody-dependent cellular cytotoxicity (ADCC) offers insights into enhancing the efficacy of therapeutic antibodies. Overall, the investigation of FCGR2B recombinant proteins not only advances our understanding of immune system dynamics but also opens new avenues for the development of targeted therapies in treating immune-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US