Analytical Data
-
Gene name
FCGR2A
- Application
-
Alternative Names
FCGR2A;Tyrosine-Protein kinase HCK
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12318
-
Expression Region
34-217aa
-
AA Sequence
QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG
-
Molecular Weight
24.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FCGR2A, part of the Fc gamma receptor family, plays a crucial role in the immune response by mediating the interaction between antibodies and immune cells. Its significance lies in its ability to bind the Fc region of IgG antibodies, facilitating processes such as phagocytosis, antibody-dependent cellular cytotoxicity (ADCC), and modulating inflammatory responses. Variations in the FCGR2A gene have been associated with differences in susceptibility to various diseases, including autoimmune disorders and infections. As a result, research into FCGR2A recombinant proteins has gained momentum to better understand its functional dynamics, role in immune modulation, and therapeutic potential. Recombinant FCGR2A proteins are utilized in both basic and applied research, providing insights into receptor-ligand interactions and enabling the development of novel immunotherapies. Moreover, studying these proteins aids in elucidating the mechanisms of action for existing antibody-based therapies, potentially leading to improved patient outcomes in diseases such as cancer and autoimmune conditions. Overall, the exploration of FCGR2A recombinant proteins offers valuable opportunities for advancing immunological research and therapeutic innovations.
