Cat: PA1000-9740

Recombinant Human CAV1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CAV1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CAV1;CAV;Caveolin-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q03135

  • Expression Region

    1-178aa

  • AA Sequence

    MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFY RLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSI YVHTVCDPLFEAVGKIFSNVRINLQKEI

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Caveolin-1 (CAV1) is a principal structural protein of caveolae, small invaginations in the plasma membrane of many cell types, which play a crucial role in various cellular processes, including signal transduction, lipid metabolism, and endocytosis. Research over the years has highlighted CAV1's important functions in regulating cellular signaling pathways, particularly those related to cancer development, cardiovascular diseases, and metabolic disorders. Its role as a tumor suppressor in several contexts suggests that alterations in CAV1 expression or function can lead to tumorigenesis. In addition, CAV1 is implicated in the modulation of several key signaling molecules, such as Ras and eNOS, thereby influencing cell proliferation and vascular function. The production of recombinant CAV1 protein has become a focus of study, as it provides a powerful tool for investigating the molecular mechanisms underlying its functions. By using recombinant techniques, researchers can produce CAV1 in a controlled environment, allowing for detailed studies on its structure-function relationships, interactions with other proteins, and its effects on cellular behavior. Such studies are vital for developing therapeutic strategies aimed at targeting CAV1-related pathways in diseases, particularly cancer. Consequently, the exploration of CAV1 as a recombinant protein not only enhances our understanding of fundamental biological processes but also opens up potential avenues for clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US