Analytical Data
-
Gene name
CAV1
- Application
-
Alternative Names
CAV1;CAV;Caveolin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q03135
-
Expression Region
1-178aa
-
AA Sequence
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFY RLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSI YVHTVCDPLFEAVGKIFSNVRINLQKEI
-
Molecular Weight
46 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Caveolin-1 (CAV1) is a principal structural protein of caveolae, small invaginations in the plasma membrane of many cell types, which play a crucial role in various cellular processes, including signal transduction, lipid metabolism, and endocytosis. Research over the years has highlighted CAV1's important functions in regulating cellular signaling pathways, particularly those related to cancer development, cardiovascular diseases, and metabolic disorders. Its role as a tumor suppressor in several contexts suggests that alterations in CAV1 expression or function can lead to tumorigenesis. In addition, CAV1 is implicated in the modulation of several key signaling molecules, such as Ras and eNOS, thereby influencing cell proliferation and vascular function. The production of recombinant CAV1 protein has become a focus of study, as it provides a powerful tool for investigating the molecular mechanisms underlying its functions. By using recombinant techniques, researchers can produce CAV1 in a controlled environment, allowing for detailed studies on its structure-function relationships, interactions with other proteins, and its effects on cellular behavior. Such studies are vital for developing therapeutic strategies aimed at targeting CAV1-related pathways in diseases, particularly cancer. Consequently, the exploration of CAV1 as a recombinant protein not only enhances our understanding of fundamental biological processes but also opens up potential avenues for clinical applications.











