Cat: PA2000-3932

Recombinant Human NOTCH2NLB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NOTCH2NLB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NOTCH2NLB;Notch homolog 2 N-terminal-like Protein B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0DPK3

  • Expression Region

    26-275aa

  • AA Sequence

    LQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN

  • Molecular Weight

    31.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NOTCH2NLB is a member of the NOTCH receptor family, which plays a critical role in cell signaling processes that regulate various developmental and physiological functions. Recent studies have highlighted the significance of NOTCH2NLB in various biological contexts, including its involvement in neuronal differentiation, tumorigenesis, and immune responses. Researchers have discovered that NOTCH2NLB can function as a key regulator in diseases such as cancer, where it may contribute to the proliferation and survival of malignant cells. The study of NOTCH2NLB recombinant proteins aims to elucidate its structure-function relationships and mechanism of action in cellular contexts. By producing and characterizing these recombinant proteins, scientists can investigate the specific pathways and interactions mediated by NOTCH2NLB, paving the way for potential therapeutic targets. Moreover, understanding the role of NOTCH2NLB in different tissue types and its differential regulation across various conditions can provide insights into its biological importance and therapeutic potential. The research into NOTCH2NLB recombinant proteins is essential not only for advancing our knowledge of NOTCH signaling pathways but also for developing innovative strategies to manipulate these pathways for therapeutic benefit in diseases where NOTCH2NLB is implicated.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US