Analytical Data
-
Gene name
GPX8
- Application
-
Alternative Names
GPX8; UNQ847/PRO1785; Probable glutathione peroxidase 8; GPx-8; GSHPx-8
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TED1
-
Expression Region
1-209aa
-
AA Sequence
MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL
-
Molecular Weight
50.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The GPX8 (glutathione peroxidase 8) protein is an important enzyme that plays a critical role in protecting cells from oxidative stress by catalyzing the reduction of hydrogen peroxide and organic peroxides. Its significance has gained attention in recent years due to its potential implications in various biological processes and diseases. Research has indicated that GPX8 may be involved in maintaining cellular redox homeostasis, which is crucial for cellular function and survival. Studies have also suggested a link between GPX8 expression levels and cancer progression, neurodegenerative diseases, and metabolic disorders, highlighting its potential as a biomarker for disease diagnosis and prognosis. Furthermore, the understanding of GPX8's structure and function can pave the way for the development of therapeutic strategies aimed at modulating its activity. By utilizing recombinant DNA technology, researchers have been able to produce GPX8 protein in sufficient quantities for detailed biochemical and structural studies. This research not only enhances our comprehension of the enzyme's activity and regulation but also provides insights into how GPX8 might be targeted in various therapeutic contexts, making it a significant focus of ongoing biomedical research.
