Analytical Data
-
Gene name
MACROD1
- Application
-
Alternative Names
MACROD1；LRP16；ADP-ribose glycohydrolase MACROD1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQ69
-
Expression Region
1-325aa
-
AA Sequence
MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAGVGAWGAAAVGRTAGVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGYRLPAKYVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPVA
-
Molecular Weight
39.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MACROD1, also known as "macrodomain-containing protein 1," has garnered significant attention in recent years due to its association with various cellular processes and diseases. This protein is characterized by its unique macrodomain, which is capable of binding to ADP-ribose, a modification that plays a crucial role in cellular signaling, DNA repair, and apoptosis. Research has revealed that MACROD1 is implicated in multiple pathophysiological contexts, including cancer, neurodegenerative disorders, and viral infections. Its potential role in modulating the DNA damage response and cellular stress pathways makes it a promising target for therapeutic interventions. Notably, MACROD1 is involved in the regulation of poly(ADP-ribose) polymerase (PARP) activity, which is vital for maintaining genomic stability. The study of recombinant MACROD1 proteins provides valuable insights into the structural and functional mechanisms underlying its interactions with ADP-ribose and other cellular components. Understanding the biophysical properties of MACROD1 through recombinant expression systems can pave the way for the development of small-molecule inhibitors or modulators that can alter its function, offering potential strategies for disease treatment. Thus, the research on MACROD1 not only enhances our understanding of fundamental cellular processes but also holds promise for the advancement of targeted therapies in various diseases.
