Analytical Data
-
Gene name
FAM50A
- Application
-
Alternative Names
FAM50A;DXS9928E;HXC26;Protein FAM50A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14320
-
Expression Region
150-339aa
-
AA Sequence
TTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEI EITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQL MYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKD ESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM50A, a member of the FAM50 gene family, has garnered attention in recent years due to its potential role in various biological processes and diseases. Initially identified as a gene involved in cellular proliferation and differentiation, FAM50A is believed to participate in the regulation of gene expression and chromatin structure. Its expression patterns have been implicated in various cancers, making it a candidate for targeted therapies and biomarker development. In addition, studies suggest that FAM50A may be involved in the cellular response to stress and apoptosis, highlighting its importance in maintaining cellular homeostasis. The production of recombinant FAM50A protein allows researchers to investigate its functional properties, interactions with other proteins, and its mechanistic pathways in greater detail. Understanding the structure and function of the FAM50A protein may provide insights into its role in human health and disease, opening avenues for potential therapeutic interventions. As research progresses, characterizing the recombinant FAM50A protein could lead to novel discoveries regarding its involvement in cellular signaling pathways and its potential as a drug target in the treatment of cancers and other diseases. Overall, the study of FAM50A and its recombinant protein forms represents a promising frontier in molecular biology, with implications for both basic research and clinical applications.











