Analytical Data
-
Gene name
GPSM3
- Application
-
Alternative Names
Activator of G-protein signaling 4; AGS4; C6orf9; G protein signalling modulator 3 (AGS3 like; C. elegans); G-protein signaling modulator 3 (AGS3-like; C. elegans); G-protein-signaling modulator 3; G18; G18.1a; G18.1b; G18.2; Gpsm3; GPSM3_HUMAN; NG1; OTTHUMP00000029351; Protein G18
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y4H4
-
Expression Region
1-160aa
-
AA Sequence
MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC
-
Molecular Weight
43.34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPSM3, or G-protein signaling modulator 3, is a pivotal protein involved in the regulation of G-protein signaling pathways, which play essential roles in various cellular processes such as growth, differentiation, and response to environmental stimuli. The dysregulation of these pathways is often linked to numerous diseases, including cancer and neurodegenerative disorders. Recent studies have suggested that GPSM3 acts not only as a modulator of G-protein signaling but also influences other critical cellular mechanisms, such as cell migration and apoptosis. Given its significant regulatory role, understanding the structure, function, and interaction networks of GPSM3 is crucial for elucidating its contribution to cellular signaling dynamics. Research investigations aim to explore the molecular mechanisms by which GPSM3 interacts with G-proteins and other cellular partners, providing insights that could facilitate the development of novel therapeutic strategies targeting related signaling pathways. Furthermore, the potential involvement of GPSM3 in disease pathogenesis emphasizes the urgency of deeper exploration into its biological functions and regulatory mechanisms. Understanding GPSM3 may pave the way for innovative interventions in conditions where G-protein signaling is aberrant.
