Analytical Data
-
Gene name
CT
- Application
-
Alternative Names
CT；CT45-1；Cancer/testis antigen family 45 member A1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5HYN5
-
Expression Region
1-189aa
-
AA Sequence
MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
-
Molecular Weight
21.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CT recombinant proteins, derived from the C terminus of various proteins, have gained significant attention in the field of biotechnology and medicine due to their diverse applications. Historically, the study of recombinant proteins began with advances in molecular cloning techniques in the 1970s, which allowed for the expression of foreign genes in host organisms. CT proteins, being integral to many cellular processes, play crucial roles in signal transduction, cell communication, and immune responses. Researchers have been particularly interested in CT recombinant proteins for their potential in developing vaccines, diagnostics, and therapeutic agents. In the context of infectious diseases, these proteins can elicit strong immune responses, making them promising candidates for vaccine development. Moreover, in cancer research, CT proteins are explored as tumor markers or targets for immunotherapy. As our understanding of protein structure and function advances, the ability to engineer CT recombinant proteins has also improved, leading to innovations in targeted drug delivery systems and personalized medicine. Overall, the study of CT recombinant proteins is a dynamic and rapidly evolving field that holds promise for addressing various health challenges.
