Analytical Data
-
Gene name
GPS2
- Application
-
Alternative Names
GPS2G protein pathway suppressor 2; GPS-2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13227
-
Expression Region
1-327aa
-
AA Sequence
MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
-
Molecular Weight
61.71 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPS2 (G-protein pathway suppressor 2) is an essential regulator involved in various cellular processes, including signal transduction, gene expression, and cell proliferation. Initial studies highlighted its role in G-protein signaling pathways, where it acts as a negative regulator, influencing diverse physiological responses. Subsequent research revealed that GPS2 also participates in the regulation of nuclear receptor activity, thereby affecting metabolic pathways and contributing to tissue homeostasis. Its involvement in tumorigenesis has garnered significant interest, as alterations in GPS2 expression or function have been associated with various cancers, indicating its potential as a biomarker or therapeutic target. Advances in protein engineering and expression systems have facilitated the production of recombinant GPS2, enabling detailed structural and functional studies. Understanding the molecular mechanisms by which GPS2 exerts its regulatory effects could pave the way for novel therapeutic strategies in diseases linked to its dysregulation. Investigating GPS2's interactions with other proteins and its localization within cellular compartments remains a critical area of research, as it provides insights into the complexity of signaling networks and the potential for targeted interventions in pathological conditions.
