Analytical Data
-
Gene name
ophA1
- Application
-
Alternative Names
ophA1;Phthalate dioxygenase reductase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P33164
-
Expression Region
1-322aa
-
AA Sequence
MTTPQEDGFLRLKIASKEKIARDIWSFELTDPQGAPLPPFEAGANLTVAVPNGSRRTYSLCNDSQERNRYVIAVKRDSNGRGGSISFIDDTSEGDAVEVSLPRNEFPLDKRAKSFILVAGGIGITPMLSMARQLRAEGLRSFRLYYLTRDPEGTAFFDELTSDEWRSDVKIHHDHGDPTKAFDFWSVFEKSKPAQHVYCCGPQALMDTVRDMTGHWPSGTVHFESFGATNTNARENTPFTVRLSRSGTSFEIPANRSILEVLRDANVRVPSSCESGTCGSCKTALCSGEADHRDMVLRDDEKGTQIMVCVSRAKSAELVL
-
Molecular Weight
35.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OphA1 is a protein derived from the bacterium *Aeromonas hydrophila*, which is known for its role in pathogenicity and virulence. Research into OphA1 primarily focuses on its potential applications in biotechnology and medicine, particularly in the development of vaccines and therapeutics. The protein has garnered attention due to its immunogenic properties, suggesting that it may be effective in eliciting an immune response against infections caused by *Aeromonas* species and possibly other pathogens. Moreover, studies have shown that OphA1 can exhibit enzymatic activities that may be harnessed for industrial applications, such as biocatalysis. Understanding the structure and function of OphA1 through sequential and functional analysis can provide insights into its mechanisms of action and help in designing modified forms of the protein with enhanced properties. The increasing incidence of *Aeromonas* infections in both aquatic animals and humans further underscores the urgency of researching OphA1. Overall, the exploration of OphA1 as a recombinant protein holds significant promise for advancing vaccine development and therapeutic strategies, thus contributing to public health and biotechnological innovations.











