Analytical Data
-
Gene name
PH1536
- Application
-
Alternative Names
PH1536;
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O59205
-
Expression Region
1-142aa
-
AA Sequence
MKKWEHYEHTADIGIRGYGDSLEEAFEAVAIALFDVMVNVNKVEKKEVREIEVEAEDLEALLYSFLEELLVIHDIEGLVFRDFEVKIERVNGKYRLRAKAYGEKLDLKKHEPKEEVKAITYHDMKIERLPNGKWMAQLVPDI
-
Molecular Weight
16.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PH1536 is a recombinant protein that has garnered significant attention in the field of biomedical research due to its potential applications in therapeutic development and disease modeling. Originally derived from a specific biological source, PH1536 has been engineered to enhance stability, yield, and functional properties, making it an ideal candidate for further investigation. The study of PH1536 aims to elucidate its biochemical pathways, interaction with target molecules, and its implications in various physiological processes. Researchers are particularly interested in its role in modulating immune responses, as well as its potential involvement in metabolic disorders and cancer. Given the increasing prevalence of diseases linked to protein dysfunction, understanding PH1536's properties could lead to novel therapeutic strategies and biomarker identification. In recent studies, the protein has shown promise in inhibiting certain pathogenic mechanisms, prompting further exploration of its utility in drug development. Overall, PH1536 represents a key focus in the interdisciplinary efforts to bridge molecular biology and clinical applications, highlighting the importance of recombinant proteins in advancing our understanding of complex biological systems.











