Cat: PA2000-8086

Recombinant Human GPRC5C Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GPRC5C

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GPRC5C; RAIG3; PSEC0087; G-protein coupled receptor family C group 5 member C; Retinoic acid-induced gene 3 protein; RAIG-3

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NQ84

  • Expression Region

    387-486aa

  • AA Sequence

    AFSMDEPVAAKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRNPYVWD

  • Molecular Weight

    36.74 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GPRC5C, a member of the G protein-coupled receptor (GPCR) family, has garnered attention in recent years due to its potential roles in various physiological and pathological processes, including cancer progression and immune system regulation. Found primarily in the epithelial tissues, GPRC5C interacts with multiple signaling pathways, influencing cell proliferation and differentiation. Its expression has been associated with diverse cancers, making it a target of interest for therapeutic strategies. Investigating the recombinant form of GPRC5C enables researchers to explore its functional mechanisms, ligand binding capabilities, and downstream signaling pathways in a controlled environment. By generating and characterizing GPRC5C as a recombinant protein, scientists can better understand its role in tumor biology and identify potential biomarkers for diagnostic or prognostic purposes. Furthermore, studying this receptor may contribute to the development of novel therapeutic agents that can modulate its activity, providing new avenues for treatment in diseases where GPRC5C is implicated. Overall, the research surrounding GPRC5C recombinant protein is vital for elucidating its biological significance and therapeutic potential in cancer and other disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US