Analytical Data
-
Gene name
OPN3
- Application
-
Alternative Names
OPN3;ECPN;Opsin-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H1Y3
-
Expression Region
1-402aa
-
AA Sequence
MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL
-
Molecular Weight
47.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OPN3, also known as neuropsin or opsin 3, is a member of the opsin family of proteins, which are primarily associated with light perception in photoreceptive organisms. Unlike classical visual opsins found in the retina, OPN3 is expressed in various tissues, including the brain, suggesting a role beyond traditional vision. The protein is involved in several physiological processes, such as the regulation of circadian rhythms, mood, and neuroprotection. Research has shown that OPN3 is activated by blue light, influencing cellular signaling pathways and potentially affecting behavior and metabolism. Its unique properties have sparked interest in exploring OPN3 as a therapeutic target for conditions related to circadian disruption, neurodegenerative diseases, and mood disorders. Furthermore, studying OPN3's structure and function can provide valuable insights into the evolution of photoreceptive proteins, helping to understand how different species adapt to their environments. The recombinant production of OPN3 in various systems facilitates detailed biochemical and biophysical studies, enabling researchers to elucidate its mechanisms of action and therapeutic potential. As the scientific community continues to uncover the roles of novel opsins, OPN3 stands out as a promising candidate for investigations into the interplay between light and biological processes, bridging the gap between sensory biology and neuroscience.











